PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01159.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Nin-like
Protein Properties Length: 943aa    MW: 105428 Da    PI: 6.0844
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01159.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.4e-29628679152
         RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    aek i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Jcr4S01159.30 628 AEKAITLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIKRWPSRKIKKV 679
                    5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.643618699IPR003035RWP-RK domain
PfamPF020424.2E-25632679IPR003035RWP-RK domain
SuperFamilySSF542771.89E-23841932No hitNo description
Gene3DG3DSA:3.10.20.2401.5E-21851931No hitNo description
PROSITE profilePS5174526.074851934IPR000270PB1 domain
SMARTSM006661.2E-22851934IPR000270PB1 domain
PfamPF005646.9E-17853932IPR000270PB1 domain
CDDcd064071.41E-37853932No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 943 aa     Download sequence    Send to blast
MEDSILSPGT MLAAHADSAM DFDDMDELLL DGCWLETIDG SEFFNPSPHN CAPLIDSSFL  60
WPTSENNDGD LVSRPSQKSN QQDERMSMLP RNSPLNESQS SSPVITQTIG QDMSSVARWG  120
NDADEGSEVS RRWWIGPKAK TPVRDRLIRA LGYINDFSKD KDVLIQIWVP VNEGGRRVLT  180
TQDQHFALVP NCQRLANYRD ISVNYQFSTE KDSKDMMGLP GRVFLGKVPE WTPDVRFFRS  240
DEYPRVGHAQ LYDVCGTLAL PVFEQGTRTC LGVIEVVTTA QKIKYRPELE TVCKALEGSY  300
YILILRMLLS SSIVTSEVDL QSSEVPIGQN VKVCDMSYEA ALSEIHEVLR SACETHKLPL  360
GQIWVPCIQQ GKRGCRHSDE NYYRCVSTVD HACYVRETGM QAFHEACSEH HLLKGQGVAG  420
EAFLTNQPCF SSDITSYRKT EYPLSHHARM FGLHAAVAIR LRSVHTGKAD FALEFFLPVD  480
CTDPEKQKDM LTSLSTIIQQ VCQSLRVVTD RELEAETGPV SEVVLPSYGR PRREDMLRVM  540
HYSESYAGDN SSLTASLTGI QQSGSVVLSY EKENQKVPID EKSMEYRISR EDYNLKRSIE  600
CGVDSEVAEG SLSSVCMGKT AERKRSKAEK AITLQVLRQY FAGSLKDAAK SIGVCPTTLK  660
RICRQHGIKR WPSRKIKKVG HSLQKLQLVI DSVQGASGAL QIGSFYTNFP ELASQKLSSS  720
PFSASKQSDH LEQSSIQTDG GTFSSQVAAP KSPSSSCSQS SSSSHSCSSG LQQNPSVFSI  780
PTSEDHIPGE NSSNGVLKRV RSDAELHASS QEEQNMLPRS QSHIPLREQP NSGNLPPLPK  840
SSSRISHEGD AQRIKVTYGN EKIRFRMPYN WKRKDLLQEI ARRFFIDDIN RYDLKYLDDD  900
NEWVLLTCDD DLEECIDVCQ SSENSTIKLS LQISHLMDGF SRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012073646.10.0PREDICTED: protein NLP4
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLB9R8N50.0B9R8N5_RICCO; Putative uncharacterized protein
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein